PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI07G19830.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 427aa    MW: 45500.2 Da    PI: 8.1158
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI07G19830.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.46e-17100147148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg W++eEde+l + ++++G g+W+++++  g+ R++k+c++rw +yl
  OMERI07G19830.1 100 RGLWSPEEDEKLMNHIAKYGHGCWSSVPKLAGLERCGKSCRLRWINYL 147
                      788*******************************************97 PP

2Myb_DNA-binding53.17.4e-17153197147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg++++eE++l+++++ +lG++ W+ Ia+ ++ gRt++++k++w++y
  OMERI07G19830.1 153 RGAFSQEEEDLIIHLHSMLGNK-WSQIAAQLP-GRTDNEVKNFWNSY 197
                      89********************.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.17695147IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.2E-2596150IPR009057Homeodomain-like
SuperFamilySSF466897.11E-3098194IPR009057Homeodomain-like
SMARTSM007173.1E-1399149IPR001005SANT/Myb domain
PfamPF002491.8E-15100147IPR001005SANT/Myb domain
CDDcd001678.10E-12103147No hitNo description
PROSITE profilePS5129427.138148202IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.0E-26151202IPR009057Homeodomain-like
SMARTSM007176.4E-16152200IPR001005SANT/Myb domain
PfamPF002497.7E-16153197IPR001005SANT/Myb domain
CDDcd001673.55E-11155198No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 427 aa     Download sequence    Send to blast
MHTTMATYLR ATSRLPPTLS PPSLSLPPFI PRLLPPPTPP LLCPSSSFRL RLRHRRRDIA  60
GGLVCSLSVV GGGNCDIEHG GVWWPSMAKR AGGARKKLRR GLWSPEEDEK LMNHIAKYGH  120
GCWSSVPKLA GLERCGKSCR LRWINYLRPD LKRGAFSQEE EDLIIHLHSM LGNKWSQIAA  180
QLPGRTDNEV KNFWNSYIKK KLRQRGIDPA THKPLAEVVA AAACARTPAV FSDAELILSS  240
IGVQPPPESY MYYDGSRYST ECGAASVGGD GSLSSLSGYS QATAEFAVDG ASASALLHCG  300
GGGPTSSGGG APAAPTAAVI PSVSSSSTLN SMAGLSPAAT TTTDEQYGNT NHLPWLELGP  360
STTTSSSAAT AAVDHYGAAL DELKWSDYVF DGYNHQLPPY NHGGIYGGGD SKDTAVHFDA  420
HALGNWC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C7e-309720224128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126150.0CP012615.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 7 sequence.
GenBankCT8361720.0CT836172.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCSN040M10, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015645477.10.0PREDICTED: myb-related protein Hv33
TrEMBLA0A0E0EEX10.0A0A0E0EEX1_9ORYZ; Uncharacterized protein
STRINGBGIOSGA026208-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP30923385
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G57560.17e-67myb domain protein 50